Anti C12orf43 pAb (ATL-HPA061739)

Atlas Antibodies

Catalog No.:
ATL-HPA061739-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 12 open reading frame 43
Gene Name: C12orf43
Alternative Gene Name: FLJ12448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029559: 51%, ENSRNOG00000001185: 49%
Entrez Gene ID: 64897
Uniprot ID: Q96C57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKKAKKVASVDSAVAATTPTSMATVQKQKSGELNGDQVSLGTKKKKKAK
Gene Sequence KKKAKKVASVDSAVAATTPTSMATVQKQKSGELNGDQVSLGTKKKKKAK
Gene ID - Mouse ENSMUSG00000029559
Gene ID - Rat ENSRNOG00000001185
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C12orf43 pAb (ATL-HPA061739)
Datasheet Anti C12orf43 pAb (ATL-HPA061739) Datasheet (External Link)
Vendor Page Anti C12orf43 pAb (ATL-HPA061739) at Atlas Antibodies

Documents & Links for Anti C12orf43 pAb (ATL-HPA061739)
Datasheet Anti C12orf43 pAb (ATL-HPA061739) Datasheet (External Link)
Vendor Page Anti C12orf43 pAb (ATL-HPA061739)