Anti C12orf4 pAb (ATL-HPA037871)

Atlas Antibodies

Catalog No.:
ATL-HPA037871-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 12 open reading frame 4
Gene Name: C12orf4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030347: 89%, ENSRNOG00000055036: 91%
Entrez Gene ID: 57102
Uniprot ID: Q9NQ89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDLKEALTQFIEEESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPSWDEDFADVYHDLIHSPASETLLNLEHNYFVSISELIGER
Gene Sequence KDLKEALTQFIEEESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPSWDEDFADVYHDLIHSPASETLLNLEHNYFVSISELIGER
Gene ID - Mouse ENSMUSG00000030347
Gene ID - Rat ENSRNOG00000055036
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C12orf4 pAb (ATL-HPA037871)
Datasheet Anti C12orf4 pAb (ATL-HPA037871) Datasheet (External Link)
Vendor Page Anti C12orf4 pAb (ATL-HPA037871) at Atlas Antibodies

Documents & Links for Anti C12orf4 pAb (ATL-HPA037871)
Datasheet Anti C12orf4 pAb (ATL-HPA037871) Datasheet (External Link)
Vendor Page Anti C12orf4 pAb (ATL-HPA037871)