Anti C12orf29 pAb (ATL-HPA039663)

Atlas Antibodies

SKU: ATL-HPA039663-25

• 
• 

Protein Description: chromosome 12 open reading frame 29
Gene Name: C12orf29
Alternative Gene Name: DKFZp434N2030
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046567: 84%, ENSRNOG00000006973: 85%
Entrez Gene ID: 91298
Uniprot ID: Q8N999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QIRNLPSLKHNDLLSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSA
• Gene Sequence: QIRNLPSLKHNDLLSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSA
• Gene ID - Mouse: ENSMUSG00000046567
• Gene ID - Rat: ENSRNOG00000006973
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.