Anti C12orf10 pAb (ATL-HPA038627)

Atlas Antibodies

SKU:
ATL-HPA038627-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 12 open reading frame 10
Gene Name: C12orf10
Alternative Gene Name: Gamm1, MYG, MYG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001285: 90%, ENSRNOG00000013343: 92%
Entrez Gene ID: 60314
Uniprot ID: Q9HB07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYALTTTLSARVARLNPTWNHPDQDTEAGFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDP
Gene Sequence RYALTTTLSARVARLNPTWNHPDQDTEAGFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDP
Gene ID - Mouse ENSMUSG00000001285
Gene ID - Rat ENSRNOG00000013343
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C12orf10 pAb (ATL-HPA038627)
Datasheet Anti C12orf10 pAb (ATL-HPA038627) Datasheet (External Link)
Vendor Page Anti C12orf10 pAb (ATL-HPA038627) at Atlas Antibodies

Documents & Links for Anti C12orf10 pAb (ATL-HPA038627)
Datasheet Anti C12orf10 pAb (ATL-HPA038627) Datasheet (External Link)
Vendor Page Anti C12orf10 pAb (ATL-HPA038627)