Anti C11orf91 pAb (ATL-HPA050487)

Atlas Antibodies

Catalog No.:
ATL-HPA050487-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 91
Gene Name: C11orf91
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032671: 78%, ENSRNOG00000010963: 80%
Entrez Gene ID: 100131378
Uniprot ID: Q3C1V1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKELELLTITGDGFDSQSYTFLKALKDEKLQGLKTKQPGKKSASL
Gene Sequence IKELELLTITGDGFDSQSYTFLKALKDEKLQGLKTKQPGKKSASL
Gene ID - Mouse ENSMUSG00000032671
Gene ID - Rat ENSRNOG00000010963
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C11orf91 pAb (ATL-HPA050487)
Datasheet Anti C11orf91 pAb (ATL-HPA050487) Datasheet (External Link)
Vendor Page Anti C11orf91 pAb (ATL-HPA050487) at Atlas Antibodies

Documents & Links for Anti C11orf91 pAb (ATL-HPA050487)
Datasheet Anti C11orf91 pAb (ATL-HPA050487) Datasheet (External Link)
Vendor Page Anti C11orf91 pAb (ATL-HPA050487)