Anti C11orf87 pAb (ATL-HPA034656)

Atlas Antibodies

SKU:
ATL-HPA034656-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 87
Gene Name: C11orf87
Alternative Gene Name: LOC399947, LOH11CR1A, NEURIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078307: 88%, ENSRNOG00000025463: 88%
Entrez Gene ID: 399947
Uniprot ID: Q6NUJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HKRRMKKRKMQRAQEEYERDHCSGSRGGGGLPRPGRQAPTHAKETRLERQPRDSPFCAPSNSSS
Gene Sequence HKRRMKKRKMQRAQEEYERDHCSGSRGGGGLPRPGRQAPTHAKETRLERQPRDSPFCAPSNSSS
Gene ID - Mouse ENSMUSG00000078307
Gene ID - Rat ENSRNOG00000025463
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C11orf87 pAb (ATL-HPA034656)
Datasheet Anti C11orf87 pAb (ATL-HPA034656) Datasheet (External Link)
Vendor Page Anti C11orf87 pAb (ATL-HPA034656) at Atlas Antibodies

Documents & Links for Anti C11orf87 pAb (ATL-HPA034656)
Datasheet Anti C11orf87 pAb (ATL-HPA034656) Datasheet (External Link)
Vendor Page Anti C11orf87 pAb (ATL-HPA034656)