Anti C11orf86 pAb (ATL-HPA039348)

Atlas Antibodies

SKU:
ATL-HPA039348-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in subsets of tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 86
Gene Name: C11orf86
Alternative Gene Name: FLJ22675
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042041: 65%, ENSRNOG00000036641: 68%
Entrez Gene ID: 254439
Uniprot ID: A6NJI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQE
Gene Sequence GTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQE
Gene ID - Mouse ENSMUSG00000042041
Gene ID - Rat ENSRNOG00000036641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C11orf86 pAb (ATL-HPA039348)
Datasheet Anti C11orf86 pAb (ATL-HPA039348) Datasheet (External Link)
Vendor Page Anti C11orf86 pAb (ATL-HPA039348) at Atlas Antibodies

Documents & Links for Anti C11orf86 pAb (ATL-HPA039348)
Datasheet Anti C11orf86 pAb (ATL-HPA039348) Datasheet (External Link)
Vendor Page Anti C11orf86 pAb (ATL-HPA039348)