Anti C11orf86 pAb (ATL-HPA039348)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039348-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C11orf86
Alternative Gene Name: FLJ22675
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042041: 65%, ENSRNOG00000036641: 68%
Entrez Gene ID: 254439
Uniprot ID: A6NJI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQE |
| Gene Sequence | GTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQE |
| Gene ID - Mouse | ENSMUSG00000042041 |
| Gene ID - Rat | ENSRNOG00000036641 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C11orf86 pAb (ATL-HPA039348) | |
| Datasheet | Anti C11orf86 pAb (ATL-HPA039348) Datasheet (External Link) |
| Vendor Page | Anti C11orf86 pAb (ATL-HPA039348) at Atlas Antibodies |
| Documents & Links for Anti C11orf86 pAb (ATL-HPA039348) | |
| Datasheet | Anti C11orf86 pAb (ATL-HPA039348) Datasheet (External Link) |
| Vendor Page | Anti C11orf86 pAb (ATL-HPA039348) |