Anti C11orf84 pAb (ATL-HPA050313)

Atlas Antibodies

SKU:
ATL-HPA050313-100
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 84
Gene Name: C11orf84
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024970: 81%, ENSRNOG00000025061: 80%
Entrez Gene ID: 144097
Uniprot ID: Q9BUA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGNKKPRGQRWKEPPGEEPVRKKRGRPMTKNLDPDPEPPSPDSPTETFAAPAEVRHFTDGSFPAGFVLQLFSHTQLRGPDSKDSPKDREVAEG
Gene Sequence PGNKKPRGQRWKEPPGEEPVRKKRGRPMTKNLDPDPEPPSPDSPTETFAAPAEVRHFTDGSFPAGFVLQLFSHTQLRGPDSKDSPKDREVAEG
Gene ID - Mouse ENSMUSG00000024970
Gene ID - Rat ENSRNOG00000025061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C11orf84 pAb (ATL-HPA050313)
Datasheet Anti C11orf84 pAb (ATL-HPA050313) Datasheet (External Link)
Vendor Page Anti C11orf84 pAb (ATL-HPA050313) at Atlas Antibodies

Documents & Links for Anti C11orf84 pAb (ATL-HPA050313)
Datasheet Anti C11orf84 pAb (ATL-HPA050313) Datasheet (External Link)
Vendor Page Anti C11orf84 pAb (ATL-HPA050313)