Anti C11orf84 pAb (ATL-HPA040128)

Atlas Antibodies

SKU: ATL-HPA040128-25

• 

Protein Description: chromosome 11 open reading frame 84
Gene Name: C11orf84
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024970: 88%, ENSRNOG00000025061: 89%
Entrez Gene ID: 144097
Uniprot ID: Q9BUA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQEFLVGSSPGGSGRALCMVCGAEIRAPS
• Gene Sequence: DCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQEFLVGSSPGGSGRALCMVCGAEIRAPS
• Gene ID - Mouse: ENSMUSG00000024970
• Gene ID - Rat: ENSRNOG00000025061
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C11orf84 pAb (ATL-HPA040128) – 1 Found

Du, Yongming; Yan, Yinxia; Xie, Si; Huang, Hao; Wang, Xin; Ng, Ray Kit; Zhou, Ming-Ming; Qian, Chengmin. Structural mechanism of bivalent histone H3K4me3K9me3 recognition by the Spindlin1/C11orf84 complex in rRNA transcription activation. Nature Communications. 2021;12(1):949.