Anti C11orf84 pAb (ATL-HPA040128)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040128-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C11orf84
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024970: 88%, ENSRNOG00000025061: 89%
Entrez Gene ID: 144097
Uniprot ID: Q9BUA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQEFLVGSSPGGSGRALCMVCGAEIRAPS |
Gene Sequence | DCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQEFLVGSSPGGSGRALCMVCGAEIRAPS |
Gene ID - Mouse | ENSMUSG00000024970 |
Gene ID - Rat | ENSRNOG00000025061 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C11orf84 pAb (ATL-HPA040128) | |
Datasheet | Anti C11orf84 pAb (ATL-HPA040128) Datasheet (External Link) |
Vendor Page | Anti C11orf84 pAb (ATL-HPA040128) at Atlas Antibodies |
Documents & Links for Anti C11orf84 pAb (ATL-HPA040128) | |
Datasheet | Anti C11orf84 pAb (ATL-HPA040128) Datasheet (External Link) |
Vendor Page | Anti C11orf84 pAb (ATL-HPA040128) |
Citations for Anti C11orf84 pAb (ATL-HPA040128) – 1 Found |
Du, Yongming; Yan, Yinxia; Xie, Si; Huang, Hao; Wang, Xin; Ng, Ray Kit; Zhou, Ming-Ming; Qian, Chengmin. Structural mechanism of bivalent histone H3K4me3K9me3 recognition by the Spindlin1/C11orf84 complex in rRNA transcription activation. Nature Communications. 2021;12(1):949. PubMed |