Anti C11orf80 pAb (ATL-HPA038933)

Atlas Antibodies

SKU:
ATL-HPA038933-100
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 80
Gene Name: C11orf80
Alternative Gene Name: FLJ22531
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071691: 62%, ENSRNOG00000026579: 58%
Entrez Gene ID: 79703
Uniprot ID: Q8N6T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKVRFHFSVKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHYVSRPNFGTIESHC
Gene Sequence SYSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKVRFHFSVKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHYVSRPNFGTIESHC
Gene ID - Mouse ENSMUSG00000071691
Gene ID - Rat ENSRNOG00000026579
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C11orf80 pAb (ATL-HPA038933)
Datasheet Anti C11orf80 pAb (ATL-HPA038933) Datasheet (External Link)
Vendor Page Anti C11orf80 pAb (ATL-HPA038933) at Atlas Antibodies

Documents & Links for Anti C11orf80 pAb (ATL-HPA038933)
Datasheet Anti C11orf80 pAb (ATL-HPA038933) Datasheet (External Link)
Vendor Page Anti C11orf80 pAb (ATL-HPA038933)