Anti C11orf80 pAb (ATL-HPA038932)

Atlas Antibodies

Catalog No.:
ATL-HPA038932-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 80
Gene Name: C11orf80
Alternative Gene Name: FLJ22531
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071691: 60%, ENSRNOG00000026579: 64%
Entrez Gene ID: 79703
Uniprot ID: Q8N6T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSFRKMCLQTLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQLTLEKKDSAQGTEDAPDNSSLELLADTSGQA
Gene Sequence SSFRKMCLQTLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQLTLEKKDSAQGTEDAPDNSSLELLADTSGQA
Gene ID - Mouse ENSMUSG00000071691
Gene ID - Rat ENSRNOG00000026579
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C11orf80 pAb (ATL-HPA038932)
Datasheet Anti C11orf80 pAb (ATL-HPA038932) Datasheet (External Link)
Vendor Page Anti C11orf80 pAb (ATL-HPA038932) at Atlas Antibodies

Documents & Links for Anti C11orf80 pAb (ATL-HPA038932)
Datasheet Anti C11orf80 pAb (ATL-HPA038932) Datasheet (External Link)
Vendor Page Anti C11orf80 pAb (ATL-HPA038932)