Anti C11orf80 pAb (ATL-HPA038932)

Atlas Antibodies

Catalog No.: ATL-HPA038932-25

Protein Description: chromosome 11 open reading frame 80
Gene Name: C11orf80
Alternative Gene Name: FLJ22531
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071691: 60%, ENSRNOG00000026579: 64%
Entrez Gene ID: 79703
Uniprot ID: Q8N6T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSFRKMCLQTLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQLTLEKKDSAQGTEDAPDNSSLELLADTSGQA
• Gene Sequence: SSFRKMCLQTLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQLTLEKKDSAQGTEDAPDNSSLELLADTSGQA
• Gene ID - Mouse: ENSMUSG00000071691
• Gene ID - Rat: ENSRNOG00000026579
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.