Anti C11orf74 pAb (ATL-HPA044880)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044880-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C11orf74
Alternative Gene Name: FLJ38678, HEPIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027165: 72%, ENSRNOG00000037567: 57%
Entrez Gene ID: 119710
Uniprot ID: Q86VG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSE |
Gene Sequence | MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSE |
Gene ID - Mouse | ENSMUSG00000027165 |
Gene ID - Rat | ENSRNOG00000037567 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C11orf74 pAb (ATL-HPA044880) | |
Datasheet | Anti C11orf74 pAb (ATL-HPA044880) Datasheet (External Link) |
Vendor Page | Anti C11orf74 pAb (ATL-HPA044880) at Atlas Antibodies |
Documents & Links for Anti C11orf74 pAb (ATL-HPA044880) | |
Datasheet | Anti C11orf74 pAb (ATL-HPA044880) Datasheet (External Link) |
Vendor Page | Anti C11orf74 pAb (ATL-HPA044880) |