Anti C11orf71 pAb (ATL-HPA074787)

Atlas Antibodies

Catalog No.:
ATL-HPA074787-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 71
Gene Name: C11orf71
Alternative Gene Name: FLJ20010
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042293: 68%, ENSRNOG00000005918: 66%
Entrez Gene ID: 54494
Uniprot ID: Q6IPW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRPSVRAESRRVDGGGRSPREPDGRGRSRQARFSPYPIPAVEPDLLRSVL
Gene Sequence VRPSVRAESRRVDGGGRSPREPDGRGRSRQARFSPYPIPAVEPDLLRSVL
Gene ID - Mouse ENSMUSG00000042293
Gene ID - Rat ENSRNOG00000005918
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C11orf71 pAb (ATL-HPA074787)
Datasheet Anti C11orf71 pAb (ATL-HPA074787) Datasheet (External Link)
Vendor Page Anti C11orf71 pAb (ATL-HPA074787) at Atlas Antibodies

Documents & Links for Anti C11orf71 pAb (ATL-HPA074787)
Datasheet Anti C11orf71 pAb (ATL-HPA074787) Datasheet (External Link)
Vendor Page Anti C11orf71 pAb (ATL-HPA074787)