Anti C11orf71 pAb (ATL-HPA074787)

Atlas Antibodies

Catalog No.: ATL-HPA074787-25

Protein Description: chromosome 11 open reading frame 71
Gene Name: C11orf71
Alternative Gene Name: FLJ20010
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042293: 68%, ENSRNOG00000005918: 66%
Entrez Gene ID: 54494
Uniprot ID: Q6IPW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRPSVRAESRRVDGGGRSPREPDGRGRSRQARFSPYPIPAVEPDLLRSVL
• Gene Sequence: VRPSVRAESRRVDGGGRSPREPDGRGRSRQARFSPYPIPAVEPDLLRSVL
• Gene ID - Mouse: ENSMUSG00000042293
• Gene ID - Rat: ENSRNOG00000005918
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.