Anti C11orf71 pAb (ATL-HPA074787)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074787-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C11orf71
Alternative Gene Name: FLJ20010
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042293: 68%, ENSRNOG00000005918: 66%
Entrez Gene ID: 54494
Uniprot ID: Q6IPW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VRPSVRAESRRVDGGGRSPREPDGRGRSRQARFSPYPIPAVEPDLLRSVL |
Gene Sequence | VRPSVRAESRRVDGGGRSPREPDGRGRSRQARFSPYPIPAVEPDLLRSVL |
Gene ID - Mouse | ENSMUSG00000042293 |
Gene ID - Rat | ENSRNOG00000005918 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C11orf71 pAb (ATL-HPA074787) | |
Datasheet | Anti C11orf71 pAb (ATL-HPA074787) Datasheet (External Link) |
Vendor Page | Anti C11orf71 pAb (ATL-HPA074787) at Atlas Antibodies |
Documents & Links for Anti C11orf71 pAb (ATL-HPA074787) | |
Datasheet | Anti C11orf71 pAb (ATL-HPA074787) Datasheet (External Link) |
Vendor Page | Anti C11orf71 pAb (ATL-HPA074787) |