Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038585-25
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-C11orf70 antibody. Corresponding C11orf70 RNA-seq data are presented for the same tissues.
Immunofluorescent staining of human cell line SiHa shows localization to centrosome.
Western blot analysis in control (vector only transfected HEK293T lysate) and C11orf70 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409874).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 70
Gene Name: C11orf70
Alternative Gene Name: MGC13040
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053070: 86%, ENSRNOG00000043410: 86%
Entrez Gene ID: 85016
Uniprot ID: Q9BRQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVIS
Gene Sequence RLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVIS
Gene ID - Mouse ENSMUSG00000053070
Gene ID - Rat ENSRNOG00000043410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation)
Datasheet Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation)
Datasheet Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation)
Citations for Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) – 1 Found
Schultz, Rüdiger; Elenius, Varpu; Fassad, Mahmoud R; Freke, Grace; Rogers, Andrew; Shoemark, Amelia; Koistinen, Tiina; Mohamed, Mai A; Lim, Jacqueline S Y; Mitchison, Hannah M; Sironen, Anu I. CFAP300 mutation causing primary ciliary dyskinesia in Finland. Frontiers In Genetics. 13( 36246608):985227.  PubMed
!