Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038585-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C11orf70
Alternative Gene Name: MGC13040
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053070: 86%, ENSRNOG00000043410: 86%
Entrez Gene ID: 85016
Uniprot ID: Q9BRQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVIS |
| Gene Sequence | RLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVIS |
| Gene ID - Mouse | ENSMUSG00000053070 |
| Gene ID - Rat | ENSRNOG00000043410 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) | |
| Datasheet | Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) | |
| Datasheet | Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) |
| Citations for Anti C11orf70 pAb (ATL-HPA038585 w/enhanced validation) – 1 Found |
| Schultz, Rüdiger; Elenius, Varpu; Fassad, Mahmoud R; Freke, Grace; Rogers, Andrew; Shoemark, Amelia; Koistinen, Tiina; Mohamed, Mai A; Lim, Jacqueline S Y; Mitchison, Hannah M; Sironen, Anu I. CFAP300 mutation causing primary ciliary dyskinesia in Finland. Frontiers In Genetics. 13( 36246608):985227. PubMed |