Anti C11orf63 pAb (ATL-HPA040344)

Atlas Antibodies

Catalog No.:
ATL-HPA040344-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 63
Gene Name: C11orf63
Alternative Gene Name: FLJ23554
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032023: 58%, ENSRNOG00000008138: 49%
Entrez Gene ID: 79864
Uniprot ID: Q6NUN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSKRKLIPKLSIQSPVLHTNLNVQSTHPPLKKEDLHRISKDSLESDSESLTQEIMCHSEFDDRIRGNGMEPDSLDEEESPRWG
Gene Sequence MSKRKLIPKLSIQSPVLHTNLNVQSTHPPLKKEDLHRISKDSLESDSESLTQEIMCHSEFDDRIRGNGMEPDSLDEEESPRWG
Gene ID - Mouse ENSMUSG00000032023
Gene ID - Rat ENSRNOG00000008138
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C11orf63 pAb (ATL-HPA040344)
Datasheet Anti C11orf63 pAb (ATL-HPA040344) Datasheet (External Link)
Vendor Page Anti C11orf63 pAb (ATL-HPA040344) at Atlas Antibodies

Documents & Links for Anti C11orf63 pAb (ATL-HPA040344)
Datasheet Anti C11orf63 pAb (ATL-HPA040344) Datasheet (External Link)
Vendor Page Anti C11orf63 pAb (ATL-HPA040344)