Anti C11orf58 pAb (ATL-HPA076406)

Atlas Antibodies

Catalog No.:
ATL-HPA076406-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 58
Gene Name: C11orf58
Alternative Gene Name: SMAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030663: 89%, ENSRNOG00000053659: 85%
Entrez Gene ID: 10944
Uniprot ID: O00193
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESDSESEKEESAEELQAAEHPDEVEDPKNKKDAKSNYKMMFVKSSGS
Gene Sequence ESDSESEKEESAEELQAAEHPDEVEDPKNKKDAKSNYKMMFVKSSGS
Gene ID - Mouse ENSMUSG00000030663
Gene ID - Rat ENSRNOG00000053659
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C11orf58 pAb (ATL-HPA076406)
Datasheet Anti C11orf58 pAb (ATL-HPA076406) Datasheet (External Link)
Vendor Page Anti C11orf58 pAb (ATL-HPA076406) at Atlas Antibodies

Documents & Links for Anti C11orf58 pAb (ATL-HPA076406)
Datasheet Anti C11orf58 pAb (ATL-HPA076406) Datasheet (External Link)
Vendor Page Anti C11orf58 pAb (ATL-HPA076406)