Anti C11orf57 pAb (ATL-HPA039493)

Atlas Antibodies

SKU:
ATL-HPA039493-25
  • Immunohistochemical staining of human cerebellum shows strong nuclear positivity in purkinje cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 57
Gene Name: C11orf57
Alternative Gene Name: FLJ10726
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059820: 90%, ENSRNOG00000009958: 90%
Entrez Gene ID: 55216
Uniprot ID: Q6ZUT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSRIPLGKVLLRNVIRHTDAHNKIQEESDMWKIRELEKQMEDAYRGTKRKMLPSSSSRMRSDGFDEESQRYYWRPKNEIS
Gene Sequence MSRIPLGKVLLRNVIRHTDAHNKIQEESDMWKIRELEKQMEDAYRGTKRKMLPSSSSRMRSDGFDEESQRYYWRPKNEIS
Gene ID - Mouse ENSMUSG00000059820
Gene ID - Rat ENSRNOG00000009958
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C11orf57 pAb (ATL-HPA039493)
Datasheet Anti C11orf57 pAb (ATL-HPA039493) Datasheet (External Link)
Vendor Page Anti C11orf57 pAb (ATL-HPA039493) at Atlas Antibodies

Documents & Links for Anti C11orf57 pAb (ATL-HPA039493)
Datasheet Anti C11orf57 pAb (ATL-HPA039493) Datasheet (External Link)
Vendor Page Anti C11orf57 pAb (ATL-HPA039493)