Anti C11orf54 pAb (ATL-HPA040511)

Atlas Antibodies

SKU:
ATL-HPA040511-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 54
Gene Name: C11orf54
Alternative Gene Name: PTD012
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031938: 85%, ENSRNOG00000010887: 80%
Entrez Gene ID: 28970
Uniprot ID: Q9H0W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLN
Gene Sequence TLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLN
Gene ID - Mouse ENSMUSG00000031938
Gene ID - Rat ENSRNOG00000010887
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C11orf54 pAb (ATL-HPA040511)
Datasheet Anti C11orf54 pAb (ATL-HPA040511) Datasheet (External Link)
Vendor Page Anti C11orf54 pAb (ATL-HPA040511) at Atlas Antibodies

Documents & Links for Anti C11orf54 pAb (ATL-HPA040511)
Datasheet Anti C11orf54 pAb (ATL-HPA040511) Datasheet (External Link)
Vendor Page Anti C11orf54 pAb (ATL-HPA040511)



Citations for Anti C11orf54 pAb (ATL-HPA040511) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed