Anti C11orf54 pAb (ATL-HPA040511)
Atlas Antibodies
- SKU:
- ATL-HPA040511-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C11orf54
Alternative Gene Name: PTD012
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031938: 85%, ENSRNOG00000010887: 80%
Entrez Gene ID: 28970
Uniprot ID: Q9H0W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLN |
Gene Sequence | TLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLN |
Gene ID - Mouse | ENSMUSG00000031938 |
Gene ID - Rat | ENSRNOG00000010887 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C11orf54 pAb (ATL-HPA040511) | |
Datasheet | Anti C11orf54 pAb (ATL-HPA040511) Datasheet (External Link) |
Vendor Page | Anti C11orf54 pAb (ATL-HPA040511) at Atlas Antibodies |
Documents & Links for Anti C11orf54 pAb (ATL-HPA040511) | |
Datasheet | Anti C11orf54 pAb (ATL-HPA040511) Datasheet (External Link) |
Vendor Page | Anti C11orf54 pAb (ATL-HPA040511) |
Citations for Anti C11orf54 pAb (ATL-HPA040511) – 1 Found |
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |