Anti C11orf53 pAb (ATL-HPA073101)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073101-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C11orf53
Alternative Gene Name: MGC50104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036027: 78%, ENSRNOG00000012022: 81%
Entrez Gene ID: 341032
Uniprot ID: Q8IXP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDYRPPALTPNAGSLFS |
Gene Sequence | VTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDYRPPALTPNAGSLFS |
Gene ID - Mouse | ENSMUSG00000036027 |
Gene ID - Rat | ENSRNOG00000012022 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C11orf53 pAb (ATL-HPA073101) | |
Datasheet | Anti C11orf53 pAb (ATL-HPA073101) Datasheet (External Link) |
Vendor Page | Anti C11orf53 pAb (ATL-HPA073101) at Atlas Antibodies |
Documents & Links for Anti C11orf53 pAb (ATL-HPA073101) | |
Datasheet | Anti C11orf53 pAb (ATL-HPA073101) Datasheet (External Link) |
Vendor Page | Anti C11orf53 pAb (ATL-HPA073101) |