Anti C11orf53 pAb (ATL-HPA073101)

Atlas Antibodies

SKU:
ATL-HPA073101-25
  • Immunofluorescent staining of human cell line OE19 shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 53
Gene Name: C11orf53
Alternative Gene Name: MGC50104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036027: 78%, ENSRNOG00000012022: 81%
Entrez Gene ID: 341032
Uniprot ID: Q8IXP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDYRPPALTPNAGSLFS
Gene Sequence VTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDYRPPALTPNAGSLFS
Gene ID - Mouse ENSMUSG00000036027
Gene ID - Rat ENSRNOG00000012022
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C11orf53 pAb (ATL-HPA073101)
Datasheet Anti C11orf53 pAb (ATL-HPA073101) Datasheet (External Link)
Vendor Page Anti C11orf53 pAb (ATL-HPA073101) at Atlas Antibodies

Documents & Links for Anti C11orf53 pAb (ATL-HPA073101)
Datasheet Anti C11orf53 pAb (ATL-HPA073101) Datasheet (External Link)
Vendor Page Anti C11orf53 pAb (ATL-HPA073101)