Anti C11orf52 pAb (ATL-HPA038387)

Atlas Antibodies

Catalog No.: ATL-HPA038387-100

Protein Description: chromosome 11 open reading frame 52
Gene Name: C11orf52
Alternative Gene Name: FLJ25219, MGC14839
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032062: 63%, ENSRNOG00000051792: 65%
Entrez Gene ID: 91894
Uniprot ID: Q96A22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGNRVCCGGSWSCPSTFQKKKKTGSQTRRTLKPQPQQLQQNLPKGHETTGHTYERVLQQQGS
• Gene Sequence: MGNRVCCGGSWSCPSTFQKKKKTGSQTRRTLKPQPQQLQQNLPKGHETTGHTYERVLQQQGS
• Gene ID - Mouse: ENSMUSG00000032062
• Gene ID - Rat: ENSRNOG00000051792
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.