Anti C11orf52 pAb (ATL-HPA038387)

Atlas Antibodies

Catalog No.:
ATL-HPA038387-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 52
Gene Name: C11orf52
Alternative Gene Name: FLJ25219, MGC14839
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032062: 63%, ENSRNOG00000051792: 65%
Entrez Gene ID: 91894
Uniprot ID: Q96A22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGNRVCCGGSWSCPSTFQKKKKTGSQTRRTLKPQPQQLQQNLPKGHETTGHTYERVLQQQGS
Gene Sequence MGNRVCCGGSWSCPSTFQKKKKTGSQTRRTLKPQPQQLQQNLPKGHETTGHTYERVLQQQGS
Gene ID - Mouse ENSMUSG00000032062
Gene ID - Rat ENSRNOG00000051792
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C11orf52 pAb (ATL-HPA038387)
Datasheet Anti C11orf52 pAb (ATL-HPA038387) Datasheet (External Link)
Vendor Page Anti C11orf52 pAb (ATL-HPA038387) at Atlas Antibodies

Documents & Links for Anti C11orf52 pAb (ATL-HPA038387)
Datasheet Anti C11orf52 pAb (ATL-HPA038387) Datasheet (External Link)
Vendor Page Anti C11orf52 pAb (ATL-HPA038387)