Anti C11orf49 pAb (ATL-HPA040051 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040051-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: C11orf49
Alternative Gene Name: FLJ22210, MGC4707
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040591: 90%, ENSRNOG00000014798: 90%
Entrez Gene ID: 79096
Uniprot ID: Q9H6J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGALPDKGDLMHDPAMDEELERLLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET |
| Gene Sequence | LGALPDKGDLMHDPAMDEELERLLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET |
| Gene ID - Mouse | ENSMUSG00000040591 |
| Gene ID - Rat | ENSRNOG00000014798 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C11orf49 pAb (ATL-HPA040051 w/enhanced validation) | |
| Datasheet | Anti C11orf49 pAb (ATL-HPA040051 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C11orf49 pAb (ATL-HPA040051 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti C11orf49 pAb (ATL-HPA040051 w/enhanced validation) | |
| Datasheet | Anti C11orf49 pAb (ATL-HPA040051 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C11orf49 pAb (ATL-HPA040051 w/enhanced validation) |
| Citations for Anti C11orf49 pAb (ATL-HPA040051 w/enhanced validation) – 2 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Wang, Lei; Paudyal, Sharad C; Kang, Yuchen; Owa, Mikito; Liang, Feng-Xia; Spektor, Alexander; Knaut, Holger; Sánchez, Irma; Dynlacht, Brian D. Regulators of tubulin polyglutamylation control nuclear shape and cilium disassembly by balancing microtubule and actin assembly. Cell Research. 2022;32(2):190-209. PubMed |