Anti C11orf49 pAb (ATL-HPA040051 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040051-25

Protein Description: chromosome 11 open reading frame 49
Gene Name: C11orf49
Alternative Gene Name: FLJ22210, MGC4707
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040591: 90%, ENSRNOG00000014798: 90%
Entrez Gene ID: 79096
Uniprot ID: Q9H6J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGALPDKGDLMHDPAMDEELERLLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET
• Gene Sequence: LGALPDKGDLMHDPAMDEELERLLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET
• Gene ID - Mouse: ENSMUSG00000040591
• Gene ID - Rat: ENSRNOG00000014798
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C11orf49 pAb (ATL-HPA040051 w/enhanced validation) – 2 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Wang, Lei; Paudyal, Sharad C; Kang, Yuchen; Owa, Mikito; Liang, Feng-Xia; Spektor, Alexander; Knaut, Holger; Sánchez, Irma; Dynlacht, Brian D. Regulators of tubulin polyglutamylation control nuclear shape and cilium disassembly by balancing microtubule and actin assembly. Cell Research. 2022;32(2):190-209.