Anti C11orf45 pAb (ATL-HPA039716 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039716-25

Protein Description: chromosome 11 open reading frame 45
Gene Name: C11orf45
Alternative Gene Name: FLJ43646, MGC35558
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047085: 27%, ENSRNOG00000057701: 32%
Entrez Gene ID: 219833
Uniprot ID: Q8TAV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN
• Gene Sequence: SSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN
• Gene ID - Mouse: ENSMUSG00000047085
• Gene ID - Rat: ENSRNOG00000057701
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.