Anti C11orf45 pAb (ATL-HPA039716 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039716-25
  • Immunohistochemical staining of human breast shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C11orf45 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403415).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 45
Gene Name: C11orf45
Alternative Gene Name: FLJ43646, MGC35558
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047085: 27%, ENSRNOG00000057701: 32%
Entrez Gene ID: 219833
Uniprot ID: Q8TAV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN
Gene Sequence SSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN
Gene ID - Mouse ENSMUSG00000047085
Gene ID - Rat ENSRNOG00000057701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C11orf45 pAb (ATL-HPA039716 w/enhanced validation)
Datasheet Anti C11orf45 pAb (ATL-HPA039716 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C11orf45 pAb (ATL-HPA039716 w/enhanced validation)