Anti C11orf42 pAb (ATL-HPA063404 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063404-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $447.00
    
         
                            Gene Name: C11orf42
Alternative Gene Name: MGC34805
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078611: 81%, ENSRNOG00000030818: 82%
Entrez Gene ID: 160298
Uniprot ID: Q8N5U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | QLLRLLRSLPVAFSCLKFSLQSKGVLGPQKPLTKDPLPHGANWVRPNLSIMPPLAPTSAPAD | 
| Gene Sequence | QLLRLLRSLPVAFSCLKFSLQSKGVLGPQKPLTKDPLPHGANWVRPNLSIMPPLAPTSAPAD | 
| Gene ID - Mouse | ENSMUSG00000078611 | 
| Gene ID - Rat | ENSRNOG00000030818 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti C11orf42 pAb (ATL-HPA063404 w/enhanced validation) | |
| Datasheet | Anti C11orf42 pAb (ATL-HPA063404 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti C11orf42 pAb (ATL-HPA063404 w/enhanced validation) at Atlas Antibodies | 
| Documents & Links for Anti C11orf42 pAb (ATL-HPA063404 w/enhanced validation) | |
| Datasheet | Anti C11orf42 pAb (ATL-HPA063404 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti C11orf42 pAb (ATL-HPA063404 w/enhanced validation) | 
| Citations for Anti C11orf42 pAb (ATL-HPA063404 w/enhanced validation) – 1 Found | 
| Jamin, Soazik P; Hikmet, Feria; Mathieu, Romain; Jégou, Bernard; Lindskog, Cecilia; Chalmel, Frédéric; Primig, Michael. Combined RNA/tissue profiling identifies novel Cancer/testis genes. Molecular Oncology. 2021;15(11):3003-3023. PubMed | 
 
         
                            