Anti C11orf21 pAb (ATL-HPA037607)

Atlas Antibodies

SKU:
ATL-HPA037607-25
  • Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 21
Gene Name: C11orf21
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020211: 29%, ENSRNOG00000052296: 33%
Entrez Gene ID: 29125
Uniprot ID: Q9P2W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PHLSSQSGVEPPDRWTGTPGWPSRDQEAPGSMMPPAAAQPSAHGALVPPATAHEPVDHPALHWLACCCCLSLPGQLPLAI
Gene Sequence PHLSSQSGVEPPDRWTGTPGWPSRDQEAPGSMMPPAAAQPSAHGALVPPATAHEPVDHPALHWLACCCCLSLPGQLPLAI
Gene ID - Mouse ENSMUSG00000020211
Gene ID - Rat ENSRNOG00000052296
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C11orf21 pAb (ATL-HPA037607)
Datasheet Anti C11orf21 pAb (ATL-HPA037607) Datasheet (External Link)
Vendor Page Anti C11orf21 pAb (ATL-HPA037607) at Atlas Antibodies

Documents & Links for Anti C11orf21 pAb (ATL-HPA037607)
Datasheet Anti C11orf21 pAb (ATL-HPA037607) Datasheet (External Link)
Vendor Page Anti C11orf21 pAb (ATL-HPA037607)