Anti C10orf90 pAb (ATL-HPA038648)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038648-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C10orf90
Alternative Gene Name: bA422P15.2, FATS, FLJ32938
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030994: 59%, ENSRNOG00000027542: 62%
Entrez Gene ID: 118611
Uniprot ID: Q96M02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD |
Gene Sequence | AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD |
Gene ID - Mouse | ENSMUSG00000030994 |
Gene ID - Rat | ENSRNOG00000027542 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C10orf90 pAb (ATL-HPA038648) | |
Datasheet | Anti C10orf90 pAb (ATL-HPA038648) Datasheet (External Link) |
Vendor Page | Anti C10orf90 pAb (ATL-HPA038648) at Atlas Antibodies |
Documents & Links for Anti C10orf90 pAb (ATL-HPA038648) | |
Datasheet | Anti C10orf90 pAb (ATL-HPA038648) Datasheet (External Link) |
Vendor Page | Anti C10orf90 pAb (ATL-HPA038648) |
Citations for Anti C10orf90 pAb (ATL-HPA038648) – 1 Found |
Kenawy, Nihal; Kalirai, Helen; Sacco, Joseph J; Lake, Sarah L; Heegaard, Steffen; Larsen, Ann-Cathrine; Finger, Paul T; Milman, Tatyana; Chin, Kimberly; Mosci, Carlo; Lanza, Francesco; Moulin, Alexandre; Schmitt, Caroline A; Caujolle, Jean Pierre; Maschi, Célia; Marinkovic, Marina; Taktak, Azzam F; Heimann, Heinrich; Damato, Bertil E; Coupland, Sarah E. Conjunctival melanoma copy number alterations and correlation with mutation status, tumor features, and clinical outcome. Pigment Cell & Melanoma Research. 2019;32(4):564-575. PubMed |