Anti C10orf90 pAb (ATL-HPA038648)

Atlas Antibodies

Catalog No.: ATL-HPA038648-25

Protein Description: chromosome 10 open reading frame 90
Gene Name: C10orf90
Alternative Gene Name: bA422P15.2, FATS, FLJ32938
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030994: 59%, ENSRNOG00000027542: 62%
Entrez Gene ID: 118611
Uniprot ID: Q96M02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD
• Gene Sequence: AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD
• Gene ID - Mouse: ENSMUSG00000030994
• Gene ID - Rat: ENSRNOG00000027542
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C10orf90 pAb (ATL-HPA038648) – 1 Found

Kenawy, Nihal; Kalirai, Helen; Sacco, Joseph J; Lake, Sarah L; Heegaard, Steffen; Larsen, Ann-Cathrine; Finger, Paul T; Milman, Tatyana; Chin, Kimberly; Mosci, Carlo; Lanza, Francesco; Moulin, Alexandre; Schmitt, Caroline A; Caujolle, Jean Pierre; Maschi, Célia; Marinkovic, Marina; Taktak, Azzam F; Heimann, Heinrich; Damato, Bertil E; Coupland, Sarah E. Conjunctival melanoma copy number alterations and correlation with mutation status, tumor features, and clinical outcome. Pigment Cell & Melanoma Research. 2019;32(4):564-575.