Anti C10orf88 pAb (ATL-HPA040991 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040991-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 10 open reading frame 88
Gene Name: C10orf88
Alternative Gene Name: Em:AC073585.5, FLJ13490
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040177: 76%, ENSRNOG00000020597: 80%
Entrez Gene ID: 80007
Uniprot ID: Q9H8K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPAPGQDLVILKRNHNNKDENPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGEEYCGTSRGKNVCTVLD
Gene Sequence PPAPGQDLVILKRNHNNKDENPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGEEYCGTSRGKNVCTVLD
Gene ID - Mouse ENSMUSG00000040177
Gene ID - Rat ENSRNOG00000020597
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C10orf88 pAb (ATL-HPA040991 w/enhanced validation)
Datasheet Anti C10orf88 pAb (ATL-HPA040991 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C10orf88 pAb (ATL-HPA040991 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C10orf88 pAb (ATL-HPA040991 w/enhanced validation)
Datasheet Anti C10orf88 pAb (ATL-HPA040991 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C10orf88 pAb (ATL-HPA040991 w/enhanced validation)