Anti C10orf67 pAb (ATL-HPA038130)

Atlas Antibodies

SKU:
ATL-HPA038130-25
  • Immunofluorescent staining of human cell line HaCaT shows localization to nucleoplasm & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 10 open reading frame 67
Gene Name: C10orf67
Alternative Gene Name: MGC46732
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026734: 55%, ENSRNOG00000021898: 52%
Entrez Gene ID: 256815
Uniprot ID: Q8IYJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EELDQYKDFGFHKMESFAKETSSPKSNLEKENLEYKVENERLLQIISELEEEIQINLKENSGLEDELISMKEMAEKDHKTIQK
Gene Sequence EELDQYKDFGFHKMESFAKETSSPKSNLEKENLEYKVENERLLQIISELEEEIQINLKENSGLEDELISMKEMAEKDHKTIQK
Gene ID - Mouse ENSMUSG00000026734
Gene ID - Rat ENSRNOG00000021898
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C10orf67 pAb (ATL-HPA038130)
Datasheet Anti C10orf67 pAb (ATL-HPA038130) Datasheet (External Link)
Vendor Page Anti C10orf67 pAb (ATL-HPA038130) at Atlas Antibodies

Documents & Links for Anti C10orf67 pAb (ATL-HPA038130)
Datasheet Anti C10orf67 pAb (ATL-HPA038130) Datasheet (External Link)
Vendor Page Anti C10orf67 pAb (ATL-HPA038130)