Anti C10orf53 pAb (ATL-HPA037951 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA037951-100

• 
• 

Protein Description: chromosome 10 open reading frame 53
Gene Name: C10orf53
Alternative Gene Name: Em:AC069546.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072473: 74%, ENSRNOG00000039749: 78%
Entrez Gene ID: 282966
Uniprot ID: Q8N6V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEF
• Gene Sequence: MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEF
• Gene ID - Mouse: ENSMUSG00000072473
• Gene ID - Rat: ENSRNOG00000039749
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.