Anti C10orf35 pAb (ATL-HPA034591 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA034591-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 10 open reading frame 35
Gene Name: C10orf35
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020083: 40%, ENSRNOG00000051000: 35%
Entrez Gene ID: 219738
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRMVRILANGEIVQDDDPRVRTTTQ
Gene Sequence MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRMVRILANGEIVQDDDPRVRTTTQ
Gene ID - Mouse ENSMUSG00000020083
Gene ID - Rat ENSRNOG00000051000
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C10orf35 pAb (ATL-HPA034591 w/enhanced validation)
Datasheet Anti C10orf35 pAb (ATL-HPA034591 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C10orf35 pAb (ATL-HPA034591 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C10orf35 pAb (ATL-HPA034591 w/enhanced validation)
Datasheet Anti C10orf35 pAb (ATL-HPA034591 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C10orf35 pAb (ATL-HPA034591 w/enhanced validation)