Anti C10orf35 pAb (ATL-HPA034591 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034591-25

Protein Description: chromosome 10 open reading frame 35
Gene Name: C10orf35
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020083: 40%, ENSRNOG00000051000: 35%
Entrez Gene ID: 219738
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRMVRILANGEIVQDDDPRVRTTTQ
• Gene Sequence: MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRMVRILANGEIVQDDDPRVRTTTQ
• Gene ID - Mouse: ENSMUSG00000020083
• Gene ID - Rat: ENSRNOG00000051000
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.