Anti C10orf128 pAb (ATL-HPA058166)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058166-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C10orf128
Alternative Gene Name: Em:AC084727.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041707: 60%, ENSRNOG00000042628: 52%
Entrez Gene ID: 170371
Uniprot ID: Q5T292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRAHVLRD |
Gene Sequence | KICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRAHVLRD |
Gene ID - Mouse | ENSMUSG00000041707 |
Gene ID - Rat | ENSRNOG00000042628 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C10orf128 pAb (ATL-HPA058166) | |
Datasheet | Anti C10orf128 pAb (ATL-HPA058166) Datasheet (External Link) |
Vendor Page | Anti C10orf128 pAb (ATL-HPA058166) at Atlas Antibodies |
Documents & Links for Anti C10orf128 pAb (ATL-HPA058166) | |
Datasheet | Anti C10orf128 pAb (ATL-HPA058166) Datasheet (External Link) |
Vendor Page | Anti C10orf128 pAb (ATL-HPA058166) |