Anti C10orf128 pAb (ATL-HPA058166)

Atlas Antibodies

Catalog No.:
ATL-HPA058166-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 10 open reading frame 128
Gene Name: C10orf128
Alternative Gene Name: Em:AC084727.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041707: 60%, ENSRNOG00000042628: 52%
Entrez Gene ID: 170371
Uniprot ID: Q5T292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRAHVLRD
Gene Sequence KICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRAHVLRD
Gene ID - Mouse ENSMUSG00000041707
Gene ID - Rat ENSRNOG00000042628
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C10orf128 pAb (ATL-HPA058166)
Datasheet Anti C10orf128 pAb (ATL-HPA058166) Datasheet (External Link)
Vendor Page Anti C10orf128 pAb (ATL-HPA058166) at Atlas Antibodies

Documents & Links for Anti C10orf128 pAb (ATL-HPA058166)
Datasheet Anti C10orf128 pAb (ATL-HPA058166) Datasheet (External Link)
Vendor Page Anti C10orf128 pAb (ATL-HPA058166)