Anti C10orf113 pAb (ATL-HPA037013)

Atlas Antibodies

Catalog No.:
ATL-HPA037013-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 10 open reading frame 113
Gene Name: C10orf113
Alternative Gene Name: bA165O3.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033854: 25%, ENSRNOG00000042912: 32%
Entrez Gene ID: 387638
Uniprot ID: Q5VZT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQSWPTLARWLRRVSFSLYKPPIQAAPEPDPGNWAKSPRLSLGPEGITKGKHGFKFQGIKEKFNVSKKVLK
Gene Sequence LQSWPTLARWLRRVSFSLYKPPIQAAPEPDPGNWAKSPRLSLGPEGITKGKHGFKFQGIKEKFNVSKKVLK
Gene ID - Mouse ENSMUSG00000033854
Gene ID - Rat ENSRNOG00000042912
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C10orf113 pAb (ATL-HPA037013)
Datasheet Anti C10orf113 pAb (ATL-HPA037013) Datasheet (External Link)
Vendor Page Anti C10orf113 pAb (ATL-HPA037013) at Atlas Antibodies

Documents & Links for Anti C10orf113 pAb (ATL-HPA037013)
Datasheet Anti C10orf113 pAb (ATL-HPA037013) Datasheet (External Link)
Vendor Page Anti C10orf113 pAb (ATL-HPA037013)