Anti C10orf11 pAb (ATL-HPA050419 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA050419-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 10 open reading frame 11
Gene Name: C10orf11
Alternative Gene Name: CDA017, OCA7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063458: 92%, ENSRNOG00000011932: 33%
Entrez Gene ID: 83938
Uniprot ID: Q9H2I8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYK
Gene Sequence ELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYK
Gene ID - Mouse ENSMUSG00000063458
Gene ID - Rat ENSRNOG00000011932
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C10orf11 pAb (ATL-HPA050419 w/enhanced validation)
Datasheet Anti C10orf11 pAb (ATL-HPA050419 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C10orf11 pAb (ATL-HPA050419 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C10orf11 pAb (ATL-HPA050419 w/enhanced validation)
Datasheet Anti C10orf11 pAb (ATL-HPA050419 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C10orf11 pAb (ATL-HPA050419 w/enhanced validation)
Citations for Anti C10orf11 pAb (ATL-HPA050419 w/enhanced validation) – 1 Found
Beyers, Wyatt C; Detry, Anna M; Di Pietro, Santiago M. OCA7 is a melanosome membrane protein that defines pigmentation by regulating early stages of melanosome biogenesis. The Journal Of Biological Chemistry. 2022;298(12):102669.  PubMed