Anti C10orf11 pAb (ATL-HPA047446)

Atlas Antibodies

Catalog No.:
ATL-HPA047446-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 10 open reading frame 11
Gene Name: C10orf11
Alternative Gene Name: CDA017, OCA7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063458: 81%, ENSRNOG00000039582: 25%
Entrez Gene ID: 83938
Uniprot ID: Q9H2I8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLPNLKFLDAQKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQ
Gene Sequence KLPNLKFLDAQKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQ
Gene ID - Mouse ENSMUSG00000063458
Gene ID - Rat ENSRNOG00000039582
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C10orf11 pAb (ATL-HPA047446)
Datasheet Anti C10orf11 pAb (ATL-HPA047446) Datasheet (External Link)
Vendor Page Anti C10orf11 pAb (ATL-HPA047446) at Atlas Antibodies

Documents & Links for Anti C10orf11 pAb (ATL-HPA047446)
Datasheet Anti C10orf11 pAb (ATL-HPA047446) Datasheet (External Link)
Vendor Page Anti C10orf11 pAb (ATL-HPA047446)