Anti C10orf107 pAb (ATL-HPA041398 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041398-25
  • Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-C10orf107 antibody. Corresponding C10orf107 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 10 open reading frame 107
Gene Name: C10orf107
Alternative Gene Name: bA63A2.1, Em:AC022398.2, MGC44593
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019945: 64%, ENSRNOG00000000634: 67%
Entrez Gene ID: 219621
Uniprot ID: Q8IVU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIE
Gene Sequence EMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIE
Gene ID - Mouse ENSMUSG00000019945
Gene ID - Rat ENSRNOG00000000634
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C10orf107 pAb (ATL-HPA041398 w/enhanced validation)
Datasheet Anti C10orf107 pAb (ATL-HPA041398 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C10orf107 pAb (ATL-HPA041398 w/enhanced validation)