Anti C10orf10 pAb (ATL-HPA037819)

Atlas Antibodies

Catalog No.:
ATL-HPA037819-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 10 open reading frame 10
Gene Name: C10orf10
Alternative Gene Name: DEPP, FIG, Fseg
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048489: 57%, ENSRNOG00000023465: 54%
Entrez Gene ID: 11067
Uniprot ID: Q9NTK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDP
Gene Sequence PSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDP
Gene ID - Mouse ENSMUSG00000048489
Gene ID - Rat ENSRNOG00000023465
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C10orf10 pAb (ATL-HPA037819)
Datasheet Anti C10orf10 pAb (ATL-HPA037819) Datasheet (External Link)
Vendor Page Anti C10orf10 pAb (ATL-HPA037819) at Atlas Antibodies

Documents & Links for Anti C10orf10 pAb (ATL-HPA037819)
Datasheet Anti C10orf10 pAb (ATL-HPA037819) Datasheet (External Link)
Vendor Page Anti C10orf10 pAb (ATL-HPA037819)