Anti C10orf10 pAb (ATL-HPA037819)

Atlas Antibodies

Catalog No.: ATL-HPA037819-25

Protein Description: chromosome 10 open reading frame 10
Gene Name: C10orf10
Alternative Gene Name: DEPP, FIG, Fseg
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048489: 57%, ENSRNOG00000023465: 54%
Entrez Gene ID: 11067
Uniprot ID: Q9NTK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDP
• Gene Sequence: PSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDP
• Gene ID - Mouse: ENSMUSG00000048489
• Gene ID - Rat: ENSRNOG00000023465
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.