Anti BZW2 pAb (ATL-HPA026709)
Atlas Antibodies
- SKU:
- ATL-HPA026709-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BZW2
Alternative Gene Name: HSPC028, MST017, MSTP017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020547: 100%, ENSRNOG00000005096: 100%
Entrez Gene ID: 28969
Uniprot ID: Q9Y6E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLEL |
Gene Sequence | GTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLEL |
Gene ID - Mouse | ENSMUSG00000020547 |
Gene ID - Rat | ENSRNOG00000005096 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BZW2 pAb (ATL-HPA026709) | |
Datasheet | Anti BZW2 pAb (ATL-HPA026709) Datasheet (External Link) |
Vendor Page | Anti BZW2 pAb (ATL-HPA026709) at Atlas Antibodies |
Documents & Links for Anti BZW2 pAb (ATL-HPA026709) | |
Datasheet | Anti BZW2 pAb (ATL-HPA026709) Datasheet (External Link) |
Vendor Page | Anti BZW2 pAb (ATL-HPA026709) |