Anti BZW2 pAb (ATL-HPA026709)

Atlas Antibodies

SKU:
ATL-HPA026709-25
  • Immunohistochemical staining of human pancreas shows strong membranous positivity in intercalated ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & actin filaments.
  • Western blot analysis in human cell line SK-BR-3.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: basic leucine zipper and W2 domains 2
Gene Name: BZW2
Alternative Gene Name: HSPC028, MST017, MSTP017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020547: 100%, ENSRNOG00000005096: 100%
Entrez Gene ID: 28969
Uniprot ID: Q9Y6E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLEL
Gene Sequence GTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLEL
Gene ID - Mouse ENSMUSG00000020547
Gene ID - Rat ENSRNOG00000005096
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BZW2 pAb (ATL-HPA026709)
Datasheet Anti BZW2 pAb (ATL-HPA026709) Datasheet (External Link)
Vendor Page Anti BZW2 pAb (ATL-HPA026709) at Atlas Antibodies

Documents & Links for Anti BZW2 pAb (ATL-HPA026709)
Datasheet Anti BZW2 pAb (ATL-HPA026709) Datasheet (External Link)
Vendor Page Anti BZW2 pAb (ATL-HPA026709)