Anti BZW2 pAb (ATL-HPA022813)

Atlas Antibodies

SKU: ATL-HPA022813-25

• 
• 

Protein Description: basic leucine zipper and W2 domains 2
Gene Name: BZW2
Alternative Gene Name: HSPC028, MST017, MSTP017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020547: 100%, ENSRNOG00000005096: 99%
Entrez Gene ID: 28969
Uniprot ID: Q9Y6E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELV
• Gene Sequence: GLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELV
• Gene ID - Mouse: ENSMUSG00000020547
• Gene ID - Rat: ENSRNOG00000005096
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.