Anti BZW2 pAb (ATL-HPA022813)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022813-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BZW2
Alternative Gene Name: HSPC028, MST017, MSTP017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020547: 100%, ENSRNOG00000005096: 99%
Entrez Gene ID: 28969
Uniprot ID: Q9Y6E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELV |
| Gene Sequence | GLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELV |
| Gene ID - Mouse | ENSMUSG00000020547 |
| Gene ID - Rat | ENSRNOG00000005096 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BZW2 pAb (ATL-HPA022813) | |
| Datasheet | Anti BZW2 pAb (ATL-HPA022813) Datasheet (External Link) |
| Vendor Page | Anti BZW2 pAb (ATL-HPA022813) at Atlas Antibodies |
| Documents & Links for Anti BZW2 pAb (ATL-HPA022813) | |
| Datasheet | Anti BZW2 pAb (ATL-HPA022813) Datasheet (External Link) |
| Vendor Page | Anti BZW2 pAb (ATL-HPA022813) |