Anti BYSL pAb (ATL-HPA031219 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA031219-25
  • Immunohistochemical staining of human gastrointestinal, lymphoid tissues, placenta and testis using Anti-BYSL antibody HPA031219 (A) shows similar protein distribution across tissues to independent antibody HPA031217 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & vesicles.
  • Western blot analysis using Anti-BYSL antibody HPA031219 (A) shows similar pattern to independent antibody HPA031217 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: bystin-like
Gene Name: BYSL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023988: 78%, ENSRNOG00000049121: 83%
Entrez Gene ID: 705
Uniprot ID: Q13895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQQEELEAEHGTGDKPAAPRERTTRLGPRMPQDGSDDEDEEWPTLEKAATMTAAGHHAEVVVDPEDERAIEMFMNKNPPAR
Gene Sequence QQQEELEAEHGTGDKPAAPRERTTRLGPRMPQDGSDDEDEEWPTLEKAATMTAAGHHAEVVVDPEDERAIEMFMNKNPPAR
Gene ID - Mouse ENSMUSG00000023988
Gene ID - Rat ENSRNOG00000049121
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BYSL pAb (ATL-HPA031219 w/enhanced validation)
Datasheet Anti BYSL pAb (ATL-HPA031219 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BYSL pAb (ATL-HPA031219 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BYSL pAb (ATL-HPA031219 w/enhanced validation)
Datasheet Anti BYSL pAb (ATL-HPA031219 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BYSL pAb (ATL-HPA031219 w/enhanced validation)