Anti BYSL pAb (ATL-HPA031217 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031217-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BYSL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023988: 90%, ENSRNOG00000049121: 91%
Entrez Gene ID: 705
Uniprot ID: Q13895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE |
| Gene Sequence | LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE |
| Gene ID - Mouse | ENSMUSG00000023988 |
| Gene ID - Rat | ENSRNOG00000049121 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BYSL pAb (ATL-HPA031217 w/enhanced validation) | |
| Datasheet | Anti BYSL pAb (ATL-HPA031217 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BYSL pAb (ATL-HPA031217 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BYSL pAb (ATL-HPA031217 w/enhanced validation) | |
| Datasheet | Anti BYSL pAb (ATL-HPA031217 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BYSL pAb (ATL-HPA031217 w/enhanced validation) |
| Citations for Anti BYSL pAb (ATL-HPA031217 w/enhanced validation) – 1 Found |
| Sha, Zhuang; Zhou, Junbo; Wu, Yihao; Zhang, Tong; Li, Cheng; Meng, Qingming; Musunuru, Preethi Priyanka; You, Fangting; Wu, Yue; Yu, Rutong; Gao, Shangfeng. BYSL Promotes Glioblastoma Cell Migration, Invasion, and Mesenchymal Transition Through the GSK-3β/β-Catenin Signaling Pathway. Frontiers In Oncology. 10( 33178594):565225. PubMed |