Anti BYSL pAb (ATL-HPA031217 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA031217-25

• 
• 
• 

Protein Description: bystin-like
Gene Name: BYSL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023988: 90%, ENSRNOG00000049121: 91%
Entrez Gene ID: 705
Uniprot ID: Q13895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE
• Gene Sequence: LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE
• Gene ID - Mouse: ENSMUSG00000023988
• Gene ID - Rat: ENSRNOG00000049121
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BYSL pAb (ATL-HPA031217 w/enhanced validation) – 1 Found

Sha, Zhuang; Zhou, Junbo; Wu, Yihao; Zhang, Tong; Li, Cheng; Meng, Qingming; Musunuru, Preethi Priyanka; You, Fangting; Wu, Yue; Yu, Rutong; Gao, Shangfeng. BYSL Promotes Glioblastoma Cell Migration, Invasion, and Mesenchymal Transition Through the GSK-3β/β-Catenin Signaling Pathway. Frontiers In Oncology. 10( 33178594):565225.