Anti BVES pAb (ATL-HPA014788 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014788-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BVES
Alternative Gene Name: HBVES, POP1, POPDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071317: 79%, ENSRNOG00000056151: 25%
Entrez Gene ID: 11149
Uniprot ID: Q8NE79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP |
Gene Sequence | LNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP |
Gene ID - Mouse | ENSMUSG00000071317 |
Gene ID - Rat | ENSRNOG00000056151 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BVES pAb (ATL-HPA014788 w/enhanced validation) | |
Datasheet | Anti BVES pAb (ATL-HPA014788 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BVES pAb (ATL-HPA014788 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BVES pAb (ATL-HPA014788 w/enhanced validation) | |
Datasheet | Anti BVES pAb (ATL-HPA014788 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BVES pAb (ATL-HPA014788 w/enhanced validation) |
Citations for Anti BVES pAb (ATL-HPA014788 w/enhanced validation) – 2 Found |
De Ridder, Willem; Nelson, Isabelle; Asselbergh, Bob; De Paepe, Boel; Beuvin, Maud; Ben Yaou, Rabah; Masson, Cécile; Boland, Anne; Deleuze, Jean-François; Maisonobe, Thierry; Eymard, Bruno; Symoens, Sofie; Schindler, Roland; Brand, Thomas; Johnson, Katherine; Töpf, Ana; Straub, Volker; De Jonghe, Peter; De Bleecker, Jan L; Bonne, Gisèle; Baets, Jonathan. Muscular dystrophy with arrhythmia caused by loss-of-function mutations in BVES. Neurology. Genetics. 2019;5(2):e321. PubMed |
Li, Haiwen; Xu, Li; Gao, Yandi; Zuo, Yuanbojiao; Yang, Zuocheng; Zhao, Lingling; Chen, Zhiheng; Guo, Shuliang; Han, Renzhi. BVES is a novel interactor of ANO5 and regulates myoblast differentiation. Cell & Bioscience. 2021;11(1):222. PubMed |