Anti BVES pAb (ATL-HPA014788 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA014788-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: blood vessel epicardial substance
Gene Name: BVES
Alternative Gene Name: HBVES, POP1, POPDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071317: 79%, ENSRNOG00000056151: 25%
Entrez Gene ID: 11149
Uniprot ID: Q8NE79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP
Gene Sequence LNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP
Gene ID - Mouse ENSMUSG00000071317
Gene ID - Rat ENSRNOG00000056151
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BVES pAb (ATL-HPA014788 w/enhanced validation)
Datasheet Anti BVES pAb (ATL-HPA014788 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BVES pAb (ATL-HPA014788 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BVES pAb (ATL-HPA014788 w/enhanced validation)
Datasheet Anti BVES pAb (ATL-HPA014788 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BVES pAb (ATL-HPA014788 w/enhanced validation)
Citations for Anti BVES pAb (ATL-HPA014788 w/enhanced validation) – 2 Found
De Ridder, Willem; Nelson, Isabelle; Asselbergh, Bob; De Paepe, Boel; Beuvin, Maud; Ben Yaou, Rabah; Masson, Cécile; Boland, Anne; Deleuze, Jean-François; Maisonobe, Thierry; Eymard, Bruno; Symoens, Sofie; Schindler, Roland; Brand, Thomas; Johnson, Katherine; Töpf, Ana; Straub, Volker; De Jonghe, Peter; De Bleecker, Jan L; Bonne, Gisèle; Baets, Jonathan. Muscular dystrophy with arrhythmia caused by loss-of-function mutations in BVES. Neurology. Genetics. 2019;5(2):e321.  PubMed
Li, Haiwen; Xu, Li; Gao, Yandi; Zuo, Yuanbojiao; Yang, Zuocheng; Zhao, Lingling; Chen, Zhiheng; Guo, Shuliang; Han, Renzhi. BVES is a novel interactor of ANO5 and regulates myoblast differentiation. Cell & Bioscience. 2021;11(1):222.  PubMed