Anti BUD31 pAb (ATL-HPA028943)

Atlas Antibodies

SKU:
ATL-HPA028943-100
  • Immunohistochemical staining of human nasopharynx shows strong cytoplasmic and nuclear positivity in respiratory epithelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & microtubules.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: BUD31 homolog (S. cerevisiae)
Gene Name: BUD31
Alternative Gene Name: Cwc14, EDG-2, EDG2, fSAP17, G10, YCR063W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038722: 100%, ENSRNOG00000000989: 100%
Entrez Gene ID: 8896
Uniprot ID: P41223
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIE
Gene Sequence DGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIE
Gene ID - Mouse ENSMUSG00000038722
Gene ID - Rat ENSRNOG00000000989
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BUD31 pAb (ATL-HPA028943)
Datasheet Anti BUD31 pAb (ATL-HPA028943) Datasheet (External Link)
Vendor Page Anti BUD31 pAb (ATL-HPA028943) at Atlas Antibodies

Documents & Links for Anti BUD31 pAb (ATL-HPA028943)
Datasheet Anti BUD31 pAb (ATL-HPA028943) Datasheet (External Link)
Vendor Page Anti BUD31 pAb (ATL-HPA028943)