Anti BUD13 pAb (ATL-HPA038341 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038341-25

• 
• 
• 

Protein Description: BUD13 homolog (S. cerevisiae)
Gene Name: BUD13
Alternative Gene Name: Cwc26, fSAP71, MGC13125
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032077: 86%, ENSRNOG00000018665: 81%
Entrez Gene ID: 84811
Uniprot ID: Q9BRD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETM
• Gene Sequence: PGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETM
• Gene ID - Mouse: ENSMUSG00000032077
• Gene ID - Rat: ENSRNOG00000018665
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.