Anti BTNL8 pAb (ATL-HPA039738)

Atlas Antibodies

Catalog No.:
ATL-HPA039738-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: butyrophilin-like 8
Gene Name: BTNL8
Alternative Gene Name: BTN9.2, FLJ21458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025968: 32%, ENSRNOG00000011849: 32%
Entrez Gene ID: 79908
Uniprot ID: Q6UX41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQA
Gene Sequence LLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQA
Gene ID - Mouse ENSMUSG00000025968
Gene ID - Rat ENSRNOG00000011849
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BTNL8 pAb (ATL-HPA039738)
Datasheet Anti BTNL8 pAb (ATL-HPA039738) Datasheet (External Link)
Vendor Page Anti BTNL8 pAb (ATL-HPA039738) at Atlas Antibodies

Documents & Links for Anti BTNL8 pAb (ATL-HPA039738)
Datasheet Anti BTNL8 pAb (ATL-HPA039738) Datasheet (External Link)
Vendor Page Anti BTNL8 pAb (ATL-HPA039738)