Anti BTNL8 pAb (ATL-HPA039738)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039738-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BTNL8
Alternative Gene Name: BTN9.2, FLJ21458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025968: 32%, ENSRNOG00000011849: 32%
Entrez Gene ID: 79908
Uniprot ID: Q6UX41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQA |
Gene Sequence | LLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQA |
Gene ID - Mouse | ENSMUSG00000025968 |
Gene ID - Rat | ENSRNOG00000011849 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BTNL8 pAb (ATL-HPA039738) | |
Datasheet | Anti BTNL8 pAb (ATL-HPA039738) Datasheet (External Link) |
Vendor Page | Anti BTNL8 pAb (ATL-HPA039738) at Atlas Antibodies |
Documents & Links for Anti BTNL8 pAb (ATL-HPA039738) | |
Datasheet | Anti BTNL8 pAb (ATL-HPA039738) Datasheet (External Link) |
Vendor Page | Anti BTNL8 pAb (ATL-HPA039738) |