Anti BTN3A1 pAb (ATL-HPA012565)

Atlas Antibodies

SKU: ATL-HPA012565-25

• 
• 

Protein Description: butyrophilin, subfamily 3, member A1
Gene Name: BTN3A1
Alternative Gene Name: BT3.1, BTF5, BTN3.1, CD277
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040283: 36%, ENSRNOG00000046377: 33%
Entrez Gene ID: 11119
Uniprot ID: O00481
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILL
• Gene Sequence: KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILL
• Gene ID - Mouse: ENSMUSG00000040283
• Gene ID - Rat: ENSRNOG00000046377
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BTN3A1 pAb (ATL-HPA012565) – 1 Found

Castella, Barbara; Kopecka, Joanna; Sciancalepore, Patrizia; Mandili, Giorgia; Foglietta, Myriam; Mitro, Nico; Caruso, Donatella; Novelli, Francesco; Riganti, Chiara; Massaia, Massimo. The ATP-binding cassette transporter A1 regulates phosphoantigen release and Vγ9Vδ2 T cell activation by dendritic cells. Nature Communications. 2017;8( 28580927):15663.