Anti BTN3A1 pAb (ATL-HPA012565)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012565-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: BTN3A1
Alternative Gene Name: BT3.1, BTF5, BTN3.1, CD277
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040283: 36%, ENSRNOG00000046377: 33%
Entrez Gene ID: 11119
Uniprot ID: O00481
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILL |
| Gene Sequence | KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILL |
| Gene ID - Mouse | ENSMUSG00000040283 |
| Gene ID - Rat | ENSRNOG00000046377 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BTN3A1 pAb (ATL-HPA012565) | |
| Datasheet | Anti BTN3A1 pAb (ATL-HPA012565) Datasheet (External Link) |
| Vendor Page | Anti BTN3A1 pAb (ATL-HPA012565) at Atlas Antibodies |
| Documents & Links for Anti BTN3A1 pAb (ATL-HPA012565) | |
| Datasheet | Anti BTN3A1 pAb (ATL-HPA012565) Datasheet (External Link) |
| Vendor Page | Anti BTN3A1 pAb (ATL-HPA012565) |
| Citations for Anti BTN3A1 pAb (ATL-HPA012565) – 1 Found |
| Castella, Barbara; Kopecka, Joanna; Sciancalepore, Patrizia; Mandili, Giorgia; Foglietta, Myriam; Mitro, Nico; Caruso, Donatella; Novelli, Francesco; Riganti, Chiara; Massaia, Massimo. The ATP-binding cassette transporter A1 regulates phosphoantigen release and Vγ9Vδ2 T cell activation by dendritic cells. Nature Communications. 2017;8( 28580927):15663. PubMed |