Anti BTN3A1 pAb (ATL-HPA012565)

Atlas Antibodies

Catalog No.:
ATL-HPA012565-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: butyrophilin, subfamily 3, member A1
Gene Name: BTN3A1
Alternative Gene Name: BT3.1, BTF5, BTN3.1, CD277
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040283: 36%, ENSRNOG00000046377: 33%
Entrez Gene ID: 11119
Uniprot ID: O00481
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILL
Gene Sequence KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILL
Gene ID - Mouse ENSMUSG00000040283
Gene ID - Rat ENSRNOG00000046377
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BTN3A1 pAb (ATL-HPA012565)
Datasheet Anti BTN3A1 pAb (ATL-HPA012565) Datasheet (External Link)
Vendor Page Anti BTN3A1 pAb (ATL-HPA012565) at Atlas Antibodies

Documents & Links for Anti BTN3A1 pAb (ATL-HPA012565)
Datasheet Anti BTN3A1 pAb (ATL-HPA012565) Datasheet (External Link)
Vendor Page Anti BTN3A1 pAb (ATL-HPA012565)
Citations for Anti BTN3A1 pAb (ATL-HPA012565) – 1 Found
Castella, Barbara; Kopecka, Joanna; Sciancalepore, Patrizia; Mandili, Giorgia; Foglietta, Myriam; Mitro, Nico; Caruso, Donatella; Novelli, Francesco; Riganti, Chiara; Massaia, Massimo. The ATP-binding cassette transporter A1 regulates phosphoantigen release and Vγ9Vδ2 T cell activation by dendritic cells. Nature Communications. 2017;8( 28580927):15663.  PubMed