Anti BTN2A1 pAb (ATL-HPA019208)

Atlas Antibodies

Catalog No.:
ATL-HPA019208-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: butyrophilin, subfamily 2, member A1
Gene Name: BTN2A1
Alternative Gene Name: BT2.1, BTF1, BTN2.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053216: 39%, ENSRNOG00000003185: 38%
Entrez Gene ID: 11120
Uniprot ID: Q7KYR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLD
Gene Sequence ILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLD
Gene ID - Mouse ENSMUSG00000053216
Gene ID - Rat ENSRNOG00000003185
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BTN2A1 pAb (ATL-HPA019208)
Datasheet Anti BTN2A1 pAb (ATL-HPA019208) Datasheet (External Link)
Vendor Page Anti BTN2A1 pAb (ATL-HPA019208) at Atlas Antibodies

Documents & Links for Anti BTN2A1 pAb (ATL-HPA019208)
Datasheet Anti BTN2A1 pAb (ATL-HPA019208) Datasheet (External Link)
Vendor Page Anti BTN2A1 pAb (ATL-HPA019208)
Citations for Anti BTN2A1 pAb (ATL-HPA019208) – 1 Found
Karunakaran, Mohindar M; Willcox, Carrie R; Salim, Mahboob; Paletta, Daniel; Fichtner, Alina S; Noll, Angela; Starick, Lisa; Nöhren, Anna; Begley, Charlotte R; Berwick, Katie A; Chaleil, Raphaël A G; Pitard, Vincent; Déchanet-Merville, Julie; Bates, Paul A; Kimmel, Brigitte; Knowles, Timothy J; Kunzmann, Volker; Walter, Lutz; Jeeves, Mark; Mohammed, Fiyaz; Willcox, Benjamin E; Herrmann, Thomas. Butyrophilin-2A1 Directly Binds Germline-Encoded Regions of the Vγ9Vδ2 TCR and Is Essential for Phosphoantigen Sensing. Immunity. 2020;52(3):487-498.e6.  PubMed