Anti BTN1A1 pAb (ATL-HPA011126)

Atlas Antibodies

SKU:
ATL-HPA011126-25
  • Immunohistochemical staining of human lactating breast shows strong membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: butyrophilin, subfamily 1, member A1
Gene Name: BTN1A1
Alternative Gene Name: BT, BTN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000706: 71%, ENSRNOG00000017514: 71%
Entrez Gene ID: 696
Uniprot ID: Q13410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGA
Gene Sequence DYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGA
Gene ID - Mouse ENSMUSG00000000706
Gene ID - Rat ENSRNOG00000017514
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BTN1A1 pAb (ATL-HPA011126)
Datasheet Anti BTN1A1 pAb (ATL-HPA011126) Datasheet (External Link)
Vendor Page Anti BTN1A1 pAb (ATL-HPA011126) at Atlas Antibodies

Documents & Links for Anti BTN1A1 pAb (ATL-HPA011126)
Datasheet Anti BTN1A1 pAb (ATL-HPA011126) Datasheet (External Link)
Vendor Page Anti BTN1A1 pAb (ATL-HPA011126)