Anti BTK pAb (ATL-HPA002028 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA002028-25
  • Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using HPA002028 antibody. Corresponding BTK RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-BTK antibody HPA002028 (A) shows similar pattern to independent antibody HPA001198 (B).
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: Bruton agammaglobulinemia tyrosine kinase
Gene Name: BTK
Alternative Gene Name: AGMX1, ATK, IMD1, PSCTK1, XLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031264: 99%, ENSRNOG00000052407: 92%
Entrez Gene ID: 695
Uniprot ID: Q06187
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQIL
Gene Sequence CVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQIL
Gene ID - Mouse ENSMUSG00000031264
Gene ID - Rat ENSRNOG00000052407
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BTK pAb (ATL-HPA002028 w/enhanced validation)
Datasheet Anti BTK pAb (ATL-HPA002028 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BTK pAb (ATL-HPA002028 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BTK pAb (ATL-HPA002028 w/enhanced validation)
Datasheet Anti BTK pAb (ATL-HPA002028 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BTK pAb (ATL-HPA002028 w/enhanced validation)



Citations for Anti BTK pAb (ATL-HPA002028 w/enhanced validation) – 2 Found
Wei, Li; Su, Yu-Kai; Lin, Chien-Min; Chao, Tsu-Yi; Huang, Shang-Pen; Huynh, Thanh-Tuan; Jan, Hsun-Jin; Whang-Peng, Jacqueline; Chiou, Jeng-Fong; Wu, Alexander T H; Hsiao, Michael. Preclinical investigation of ibrutinib, a Bruton's kinase tyrosine (Btk) inhibitor, in suppressing glioma tumorigenesis and stem cell phenotypes. Oncotarget. 2016;7(43):69961-69975.  PubMed
Al Shboul, Sofian; Curran, Olimpia E; Alfaro, Javier A; Lickiss, Fiona; Nita, Erisa; Kowalski, Jacek; Naji, Faris; Nenutil, Rudolf; Ball, Kathryn L; Krejcir, Radovan; Vojtesek, Borivoj; Hupp, Ted R; Brennan, Paul M. Kinomics platform using GBM tissue identifies BTK as being associated with higher patient survival. Life Science Alliance. 2021;4(12)  PubMed