Anti BTK pAb (ATL-HPA001198 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001198-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: BTK
Alternative Gene Name: AGMX1, ATK, IMD1, PSCTK1, XLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031264: 96%, ENSRNOG00000052407: 97%
Entrez Gene ID: 695
Uniprot ID: Q06187
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL |
Gene Sequence | PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL |
Gene ID - Mouse | ENSMUSG00000031264 |
Gene ID - Rat | ENSRNOG00000052407 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BTK pAb (ATL-HPA001198 w/enhanced validation) | |
Datasheet | Anti BTK pAb (ATL-HPA001198 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BTK pAb (ATL-HPA001198 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BTK pAb (ATL-HPA001198 w/enhanced validation) | |
Datasheet | Anti BTK pAb (ATL-HPA001198 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BTK pAb (ATL-HPA001198 w/enhanced validation) |
Citations for Anti BTK pAb (ATL-HPA001198 w/enhanced validation) – 1 Found |
Sadeghi, Laia; Arvidsson, Gustav; Merrien, Magali; M Wasik, Agata; Görgens, André; Smith, C I Edvard; Sander, Birgitta; Wright, Anthony P. Differential B-Cell Receptor Signaling Requirement for Adhesion of Mantle Cell Lymphoma Cells to Stromal Cells. Cancers. 2020;12(5) PubMed |