Anti BTK pAb (ATL-HPA001198 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001198-25
  • Immunohistochemistry analysis in human tonsil and kidney tissues using HPA001198 antibody. Corresponding BTK RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
  • Western blot analysis using Anti-BTK antibody HPA001198 (A) shows similar pattern to independent antibody HPA002028 (B).
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: Bruton agammaglobulinemia tyrosine kinase
Gene Name: BTK
Alternative Gene Name: AGMX1, ATK, IMD1, PSCTK1, XLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031264: 96%, ENSRNOG00000052407: 97%
Entrez Gene ID: 695
Uniprot ID: Q06187
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL
Gene Sequence PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL
Gene ID - Mouse ENSMUSG00000031264
Gene ID - Rat ENSRNOG00000052407
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BTK pAb (ATL-HPA001198 w/enhanced validation)
Datasheet Anti BTK pAb (ATL-HPA001198 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BTK pAb (ATL-HPA001198 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BTK pAb (ATL-HPA001198 w/enhanced validation)
Datasheet Anti BTK pAb (ATL-HPA001198 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BTK pAb (ATL-HPA001198 w/enhanced validation)



Citations for Anti BTK pAb (ATL-HPA001198 w/enhanced validation) – 1 Found
Sadeghi, Laia; Arvidsson, Gustav; Merrien, Magali; M Wasik, Agata; Görgens, André; Smith, C I Edvard; Sander, Birgitta; Wright, Anthony P. Differential B-Cell Receptor Signaling Requirement for Adhesion of Mantle Cell Lymphoma Cells to Stromal Cells. Cancers. 2020;12(5)  PubMed