Anti BTG4 pAb (ATL-HPA057157)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057157-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BTG4
Alternative Gene Name: PC3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032056: 87%, ENSRNOG00000011277: 89%
Entrez Gene ID: 54766
Uniprot ID: Q9NY30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE |
Gene Sequence | GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE |
Gene ID - Mouse | ENSMUSG00000032056 |
Gene ID - Rat | ENSRNOG00000011277 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BTG4 pAb (ATL-HPA057157) | |
Datasheet | Anti BTG4 pAb (ATL-HPA057157) Datasheet (External Link) |
Vendor Page | Anti BTG4 pAb (ATL-HPA057157) at Atlas Antibodies |
Documents & Links for Anti BTG4 pAb (ATL-HPA057157) | |
Datasheet | Anti BTG4 pAb (ATL-HPA057157) Datasheet (External Link) |
Vendor Page | Anti BTG4 pAb (ATL-HPA057157) |