Anti BTG4 pAb (ATL-HPA057157)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057157-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BTG4
Alternative Gene Name: PC3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032056: 87%, ENSRNOG00000011277: 89%
Entrez Gene ID: 54766
Uniprot ID: Q9NY30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE |
| Gene Sequence | GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE |
| Gene ID - Mouse | ENSMUSG00000032056 |
| Gene ID - Rat | ENSRNOG00000011277 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BTG4 pAb (ATL-HPA057157) | |
| Datasheet | Anti BTG4 pAb (ATL-HPA057157) Datasheet (External Link) |
| Vendor Page | Anti BTG4 pAb (ATL-HPA057157) at Atlas Antibodies |
| Documents & Links for Anti BTG4 pAb (ATL-HPA057157) | |
| Datasheet | Anti BTG4 pAb (ATL-HPA057157) Datasheet (External Link) |
| Vendor Page | Anti BTG4 pAb (ATL-HPA057157) |