Anti BTG4 pAb (ATL-HPA057157)

Atlas Antibodies

Catalog No.:
ATL-HPA057157-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: B-cell translocation gene 4
Gene Name: BTG4
Alternative Gene Name: PC3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032056: 87%, ENSRNOG00000011277: 89%
Entrez Gene ID: 54766
Uniprot ID: Q9NY30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE
Gene Sequence GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE
Gene ID - Mouse ENSMUSG00000032056
Gene ID - Rat ENSRNOG00000011277
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BTG4 pAb (ATL-HPA057157)
Datasheet Anti BTG4 pAb (ATL-HPA057157) Datasheet (External Link)
Vendor Page Anti BTG4 pAb (ATL-HPA057157) at Atlas Antibodies

Documents & Links for Anti BTG4 pAb (ATL-HPA057157)
Datasheet Anti BTG4 pAb (ATL-HPA057157) Datasheet (External Link)
Vendor Page Anti BTG4 pAb (ATL-HPA057157)