Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018400-25

• 
• 

Protein Description: BTG family, member 3
Gene Name: BTG3
Alternative Gene Name: ANA, tob55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044645: 90%, ENSRNOG00000001555: 90%
Entrez Gene ID: 10950
Uniprot ID: Q14201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT
• Gene Sequence: VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT
• Gene ID - Mouse: ENSMUSG00000044645
• Gene ID - Rat: ENSRNOG00000001555
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BTG3 pAb (ATL-HPA018400 w/enhanced validation) – 1 Found

Deng, Boya; Zhao, Yang; Gou, Wenfeng; Chen, Shuo; Mao, Xiaoyun; Takano, Yasuo; Zheng, Huachuan. Decreased expression of BTG3 was linked to carcinogenesis, aggressiveness, and prognosis of ovarian carcinoma. Tumour Biology : The Journal Of The International Society For Oncodevelopmental Biology And Medicine. 2013;34(5):2617-24.